Product Attributes CAS # : 2103905-91-3 Molecular Formula : C201H325N65O67 Sequence (AA) : (D-Arg)9-LTLRKEPASEIAQSILEAYSQNGWANRRSAGGKRPPPRRRQRRKKRG Molecular Weight : ~4598 g/mol PubChem CID : N/A (peptide not indexed) Half-Life : ~2-4 hours Synonyms : Proxofim, FOXO4-D-Retro-Inverso, FOXO4-p53 Interfering Peptide Type : Synthetic D-retro-inverso peptide (senolytic research compound) Research Focus : Longevity & Senescence, Cellular Repair Scientific References Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging Animal | In vitro FOXO4-DRI peptide selectively induces apoptosis in senescent cells Animal | In vitro Senolytics: Eliminating Senescent Cells and Alleviating Intervertebral Disc Degeneration Animal | In vitro Cellular senescence: Defining a path forward Observational | Animal | In vitro The role of senescent cells in ageing Animal | In vitro FOXO4 peptide disrupts FOXO4-p53 interaction to target senescent cells Animal | In vitro Senolytic therapy alleviates age-associated bone loss in mice Animal | In vitro Therapeutic interventions for aging: the case of cellular senescence Observational | Animal | In vitro Included In The Box Every product arrives in a premium, custom-designed PEPTIDE.Power box , engineered for convenience, hygiene, and safe storage in your refrigerator
Historically, research focused on identifying AD drug targets and interventions have experienced significant failures with a 1% success rate (8)
The balance between NAD+ and NADH reflects the cell's energy status, and this ratio must stay balanced for cells to function properly
doi: 10.2174/0113894501312703240826070530 188
Together, these ingredients create a unique blend of antioxidant eye drops nutrients that help support healthy vision and lens wellness
Her Infusion $150 Her Infusion offers targeted relief for PMS symptoms through a powerful blend of Magnesium and B6, designed to relax muscles and alleviate nausea
